PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn226451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 672aa    MW: 72985.4 Da    PI: 6.9398
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn226451genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.37.1e-28223276155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Achn226451 223 KPRVVWSVELHQQFVSAVSQL-GIDKAVPKRILELMNVPGLTRENVASHLQKFRL 276
                 79*******************.********************************8 PP

2Response_reg76.59.6e-26391471109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+ + +++l+q+l +  y +v+++++++ al+ll+ek+  +D++l D+ mp+mdG++ll++   e  +lp+i+++a g  + + + ++ Ga 
    Achn226451  39 VLVVDDDVTCLRILEQMLWRCTY-HVTTCSQATVALNLLREKRgcFDVVLSDVHMPDMDGFKLLEHVGLEM-DLPVIMMSADGRTSAVMRGIRHGAC 133
                   89*********************.*******************************************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
    Achn226451 134 DYLIKPIREEELKN 147
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23006.4E-4236172No hitNo description
SuperFamilySSF521727.97E-3636163IPR011006CheY-like superfamily
SMARTSM004482.1E-2837149IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.58338153IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.2E-2239147IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.66E-2540152No hitNo description
SuperFamilySSF466893.58E-19220280IPR009057Homeodomain-like
PROSITE profilePS5129411.422220279IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-29221281IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-24223276IPR006447Myb domain, plants
PfamPF002491.8E-6225274IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MAALQKLPQL SACMVANEPS STCKPELVVS DQFPAGLRVL VVDDDVTCLR ILEQMLWRCT  60
YHVTTCSQAT VALNLLREKR GCFDVVLSDV HMPDMDGFKL LEHVGLEMDL PVIMMSADGR  120
TSAVMRGIRH GACDYLIKPI REEELKNIWQ HVVRKRWNEN KEHEHSGSLD DNDRHKRGND  180
DAEYASSVYE EAEGLLKAQK KRRDAKEEDD GDLDSDDPAT AKKPRVVWSV ELHQQFVSAV  240
SQLGIDKAVP KRILELMNVP GLTRENVASH LQKFRLYLKR LSGVAQQQGG MSSSYCGSVE  300
QNGKPGSLGR FDIQALAASG HIPPQTLAAL HAELLGRPTG NLVLPGMDQP LLQASLQGPK  360
RISVDHGVAY GHPLVRCPAN ISKHFPQAII TADDVRSGLG AWPSNGPGTV GPSSNLGGLV  420
GQSGNILMGM LHHQQQQPRP HHQPQQQQKQ VTQPDPSRSI NVQPSCLVVP SQSSASFQAG  480
KNPVSINRNC SFNRSSSMDY SLLSSQSNNS SFGIAQIMDG DPKTTSVLNG YPGPGSVSPS  540
MSSCSINAEN AANRQLQNST VASNAARQLP VLAPNVCDFQ GSYNTKSGHV LDQGPLRNLG  600
FVGKGTSIPS RFAVDEPDSP MSNLNCGRIY GENNENKVKQ EPSMEFIESA KVGIPILQNF  660
SSNDLMSVFS E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22222282464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651276.10.0PREDICTED: two-component response regulator ARR1 isoform X1
SwissprotA2XE311e-163ORR21_ORYSI; Two-component response regulator ORR21
TrEMBLF6HFD20.0F6HFD2_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g05830.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77492130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-120response regulator 2